HPA017593

NUDT4 antibody from Sigma-Aldrich
DIPP2, DIPP2alpha, DIPP2beta, HDCMB47P, KIAA0487
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017593, RRID:AB_1854703
Product name
Anti-NUDT4P1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017593
Antibody type
Polyclonal
Antigen
Diphosphoinositol polyphosphate phosphohydrolase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPD
NNALFVTAAQTSGLPSSVR
Storage
-20C
Provider Type Product Number
- No reagents -