HPA003391

RNASE9 antibody from Sigma-Aldrich
h461, RAK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003391
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003391, RRID:AB_1079820
Product name
Anti-RNASE9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003391
Antibody type
Polyclonal
Antigen
Ribonuclease-like protein 9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMP
LNHIEYCNHEIMGKNVYYKHRWVAEHYFLLMQYDE
LQKICYNRFVPCKNGIRKCNRSKGLVEGVYCNLT
Storage
-20C
Provider Type Product Number
- No reagents -