HPA006288

TP63 antibody from Sigma-Aldrich
EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006288
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006288, RRID:AB_1080334
Product name
Anti-TP63 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006288
Antibody type
Polyclonal
Antigen
Tumor protein 63 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CACPGRDRKADEDSIRKQQVSDSTKNGDAFRQNTH
GIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIK
ESLELMQYLPQHTIETYRQQQQQQHQ
Storage
-20C
Provider Type Product Number
- No reagents -