HPA006288

TP63 antibody from MilliporeSigma / Merck KGaA
EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006288
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006288, RRID:AB_1080334
Product name
Anti-TP63 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006288
Antibody type
Polyclonal
Antigen
Tumor protein 63 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CACPGRDRKADEDSIRKQQVSDSTKNGDAFRQNTH
GIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIK
ESLELMQYLPQHTIETYRQQQQQQHQ
Storage
-20C
Provider Type Product Number
- No reagents -