ABIN630319

antibody from antibodies-online

Targeting: COX15 CEMCOX2

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630319 - Provider product page
Provider: antibodies-online
Product name: anti-Cytochrome C Oxidase Assembly Homolog 15 (Yeast) (COX15) antibody
Antibody type: Polyclonal
Antigen: COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

COX15 protein structure - ABIN630319 shown in red.