Antibody data

Product number
ABIN502077
Provider
antibodies-online
Product name
anti-Frizzled Family Receptor 2 (FZD2) antibody
Provider product page
antibodies-online - ABIN502077
Antibody type
Polyclonal
Antigen
The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2
Reactivity
Human, Mouse, Rat, Canine
Host
Rabbit
Antigen sequence
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPD
HGFCQ PISIPLCTDI
Vial size
50 µg
Provider Type Product Number
- No reagents -