HPA023387

MEIOC antibody from Sigma-Aldrich
C17orf104, FLJ35848
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023387
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023387, RRID:AB_1848899
Product name
Anti-AC091152.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023387
Antibody type
Polyclonal
Antigen
Uncharacterized protein FLJ35848 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQLGSNGFPLRSTHPFGHSVVPLLDSYDLLSYDDL
SHLYPYFNMMYGDNSFSGLMPTFGFQRPIKTRSGP
ASELHIRLEECCEQWRALEKERKKTELALAKNYPG
KKVSSTNNTPVPRLTSNPSRVDRLIVDELRELAR
Storage
-20C
Provider Type Product Number
- No reagents -