HPA020116

LSM8 antibody from Sigma-Aldrich
YJR022W
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020116
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020116, RRID:AB_1853385
Product name
Anti-LSM8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020116
Antibody type
Polyclonal
Antigen
U6 snRNA-associated Sm-like protein LSm8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALENYINRTVAVITSDGRMIVGTLKGFDQTINLIL
DESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEI
DEETDSALDLGNIRAEP
Storage
-20C
Provider Type Product Number
- No reagents -