Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183473 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tumor Susceptibility Gene 101 (TSG101) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TSG101 antibody: synthetic peptide corresponding to a region of Mouse
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYT
ATGPP NTSYMPGMPS- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic mapping of putative Chrna7 and Luzp2 neuronal transcriptional enhancers due to impact of a transgene-insertion and 6.8 Mb deletion in a mouse model of Prader-Willi and Angelman syndromes.
Stefan M, Claiborn KC, Stasiek E, Chai JH, Ohta T, Longnecker R, Greally JM, Nicholls RD
BMC genomics 2005 Nov 9;6:157
BMC genomics 2005 Nov 9;6:157
No comments: Submit comment
No validations: Submit validation data