HPA006161

TSG101 antibody from Sigma-Aldrich
TSG10, VPS23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006161
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006161, RRID:AB_1080408
Product name
Anti-TSG101 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006161
Antibody type
Polyclonal
Antigen
Tumor susceptibility gene 101 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVT
RLDQEVAEVDKNIELLKKKDEELSSALEKMENQSE
NNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYL
GEALRRGVIDLDVFLKHVRLLS
Storage
-20C
Provider Type Product Number
- No reagents -