HPA007847

VPS9D1 antibody from Atlas Antibodies
ATP-BL, C16orf7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007847
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007847, RRID:AB_1845582
Product name
Anti-VPS9D1
Provider product page
Atlas Antibodies - HPA007847
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAYTEYLRSIHYISQVLLEEVETTKEAGETVPPDT
SKMLKLAQQCLERAQSTAAKLGKTRLKPTMPAAAP
IPQPAGRHRRVYSDEGGKLSPFLPPEIFQKLQGAE
SQSCKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -