HPA007847

VPS9D1 antibody from Sigma-Aldrich
ATP-BL, C16orf7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007847
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007847, RRID:AB_1845582
Product name
Anti-C16orf7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007847
Antibody type
Polyclonal
Antigen
Uncharacterized protein C16orf7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAYTEYLRSIHYISQVLLEEVETTKEAGETVPPDT
SKMLKLAQQCLERAQSTAAKLGKTRLKPTMPAAAP
IPQPAGRHRRVYSDEGGKLSPFLPPEIFQKLQGAE
SQSCKK
Storage
-20C
Provider Type Product Number
- No reagents -