HPA022021

EFTUD2 antibody from Atlas Antibodies
SNRNP116, Snrp116, Snu114, U5-116KD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022021
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022021, RRID:AB_1848032
Product name
Anti-EFTUD2
Provider product page
Atlas Antibodies - HPA022021
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDE
EDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEG
VDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIK
IAVEPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -