HPA022021

EFTUD2 antibody from Sigma-Aldrich
SNRNP116, Snrp116, Snu114, U5-116KD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022021
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022021, RRID:AB_1848032
Product name
Anti-EFTUD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022021
Antibody type
Polyclonal
Antigen
116 kDa U5 small nuclear ribonucleoprotein component recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDE
EDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEG
VDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIK
IAVEPV
Storage
-20C
Provider Type Product Number
- No reagents -