Antibody data

Product number
H00011262-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011262-M07, RRID:AB_1205010
Product name
SP140 monoclonal antibody (M07), clone 3F9
Provider product page
Abnova Corporation - H00011262-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SP140.
Antigen sequence
GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKAN
VNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSR
ASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQ
GILV
Isotype
IgG
Antibody clone number
3F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -