Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [1]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006162 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006162, RRID:AB_1857403
- Product name
- Anti-SP140
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQ
NVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNAC
HEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPK
AGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMP
KLLP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
2011-03-28
- Submitted by
- sternsdorf
- Comment
- The IF shown does not resemble the localization described for the Sp140 protein, which is typically localized in the nucleus in the form of characteristic speckles (hence the name Sp, which stands for the Speckled localization). Instead the depicted IF image resembles a staining for cytoskeletal filaments (Actin/Tubulin) and could result from nonspecific staining rather than true recognition of the Sp140antigen.As the Sp140 protein is not ubiquitously expressed, it may be necessary to use lymphoid cells for proper localization. The attached file is from the corresponding publication by Bloch et al 1999 (MCB) Sincerely, Thomas Sternsdorf Ph. D.
- Antibody rating
- 2. Poor
- Image
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA006162 antibody. Corresponding SP140 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate nuclear positivity in reaction center cells and strong nuclear positivity in lymphoid cells outside reaction centre.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN