HPA006162

SP140 antibody from Atlas Antibodies
LYSP100-A, LYSP100-B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006162
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006162, RRID:AB_1235707
Product name
Anti-SP140
Provider product page
Atlas Antibodies - HPA006162
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQ
NVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNAC
HEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPK
AGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMP
KLLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -