HPA000505

TKTL1 antibody from Sigma-Aldrich
TKR, TKT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000505
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000505, RRID:AB_1858022
Product name
Anti-TKTL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000505
Antibody type
Polyclonal
Antigen
Transketolase-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFSHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDN
DRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKY
FDRASYRVFCLMSDGESS
Storage
-20C
Provider Type Product Number
- No reagents -