Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004849-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004849-M01, RRID:AB_489915
- Product name
- CNOT3 monoclonal antibody (M01), clone 4B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CNOT3.
- Antigen sequence
MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNA
ANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNE
IKDKRQLIDNRKLIETQMERFKVVERETKT- Isotype
- IgG
- Antibody clone number
- 4B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CNOT3 contributes to early B cell development by controlling Igh rearrangement and p53 mRNA stability.
Identification of Ccr4-not complex components as regulators of transition from partial to genuine induced pluripotent stem cells.
The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
The Ccr4-NOT deadenylase subunits CNOT7 and CNOT8 have overlapping roles and modulate cell proliferation.
Inoue T, Morita M, Hijikata A, Fukuda-Yuzawa Y, Adachi S, Isono K, Ikawa T, Kawamoto H, Koseki H, Natsume T, Fukao T, Ohara O, Yamamoto T, Kurosaki T
The Journal of experimental medicine 2015 Aug 24;212(9):1465-79
The Journal of experimental medicine 2015 Aug 24;212(9):1465-79
Identification of Ccr4-not complex components as regulators of transition from partial to genuine induced pluripotent stem cells.
Kamon M, Katano M, Hiraki-Kamon K, Hishida T, Nakachi Y, Mizuno Y, Okazaki Y, Suzuki A, Hirasaki M, Ueda A, Nishimoto M, Kato H, Okuda A
Stem cells and development 2014 Sep 15;23(18):2170-9
Stem cells and development 2014 Sep 15;23(18):2170-9
The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
Doidge R, Mittal S, Aslam A, Winkler GS
PloS one 2012;7(12):e51331
PloS one 2012;7(12):e51331
The Ccr4-NOT deadenylase subunits CNOT7 and CNOT8 have overlapping roles and modulate cell proliferation.
Aslam A, Mittal S, Koch F, Andrau JC, Winkler GS
Molecular biology of the cell 2009 Sep;20(17):3840-50
Molecular biology of the cell 2009 Sep;20(17):3840-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CNOT3 monoclonal antibody (M01), clone 4B8 Western Blot analysis of CNOT3 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CNOT3 expression in transfected 293T cell line by CNOT3 monoclonal antibody (M01), clone 4B8.Lane 1: CNOT3 transfected lysate(82 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CNOT3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CNOT3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol