Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004849-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004849-M01A, RRID:AB_10738026
- Product name
- CNOT3 monoclonal antibody (M01A), clone 4B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CNOT3.
- Antigen sequence
MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNA
ANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNE
IKDKRQLIDNRKLIETQMERFKVVERETKT- Isotype
- IgG
- Antibody clone number
- 4B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CNOT3 monoclonal antibody (M01A), clone 4B8 Western Blot analysis of CNOT3 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CNOT3 expression in transfected 293T cell line by CNOT3 monoclonal antibody (M01A), clone 4B8.Lane 1: CNOT3 transfected lysate(82 KDa).Lane 2: Non-transfected lysate.