HPA027110

C1orf109 antibody from MilliporeSigma / Merck KGaA
FLJ20508
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027110
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027110, RRID:AB_10611813
Product name
Anti-C1orf109 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027110
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf109 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANI
QALPKAWDRISKDEHQDLVQDILLNVSFFLEE
Storage
-20C
Provider Type Product Number
- No reagents -