HPA023837

ZFHX4 antibody from Sigma-Aldrich
FLJ20980, ZFH4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023837
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023837, RRID:AB_1859013
Product name
Anti-ZFHX4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023837
Antibody type
Polyclonal
Antigen
Zinc finger homeobox protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESKDQENNCERPKESNVLHPNGECPVKSEPTEPGD
EDEEDAYSNELDDEEVLGELTDSIGNKDFPLLNQS
ISPLSSSVLKFIEKGTSSSSATVSDDTEKKKQTAA
VRASGSVASNYGISGKDFADA
Storage
-20C
Provider Type Product Number
- No reagents -