AV42072

PSG9 antibody from Sigma-Aldrich
PSG11, PSGII
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV42072
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV42072, RRID:AB_1855814
Product name
Anti-PSG9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV42072
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PSG9 with an internal ID of P12549
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTL
YLETPKPYISSSNLN
Storage
-20C
Provider Type Product Number
- No reagents -