HPA022949

NMT1 antibody from Sigma-Aldrich
NMT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022949
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022949, RRID:AB_1854534
Product name
Anti-NMT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022949
Antibody type
Polyclonal
Antigen
Glycylpeptide N-tetradecanoyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCEN
EEDNSYNRGGLSPANDTGAK
Storage
-20C
Provider Type Product Number
- No reagents -