H00004773-M01A

NFATC2 antibody from Abnova Corporation
NF-ATP, NFAT1, NFATp
No application information provided.

Antibody data

Product number
H00004773-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004773-M01A, RRID:AB_1577691
Product name
NFATC2 monoclonal antibody (M01A), clone 2A4
Provider product page
Abnova Corporation - H00004773-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NFATC2.
Antigen sequence
HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGP
PPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPV
SDQKEVLPAGVTIKQEQNLDQTYLDDELIDTRLSW
IQNIL
Isotype
IgG
Antibody clone number
2A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -