HPA014480

TMEM126B antibody from Sigma-Aldrich
HT007
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014480
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014480, RRID:AB_1858083
Product name
Anti-TMEM126B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014480
Antibody type
Polyclonal
Antigen
Transmembrane protein 126B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IQVWGVGTEEAPKVFKMAASMHGQPSPSLEDAKLR
RPMVIEIIE
Storage
-20C
Provider Type Product Number
- No reagents -