HPA019186

TMEM126B antibody from Sigma-Aldrich
HT007
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019186
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019186, RRID:AB_1858084
Product name
Anti-TMEM126B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019186
Antibody type
Polyclonal
Antigen
Transmembrane protein 126B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKHDALKTYASLATLPFLSTVVTDKLFVIDALYSD
NISKENC
Storage
-20C
Provider Type Product Number
- No reagents -