HPA019186

TMEM126B antibody from Atlas Antibodies
HT007
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019186
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019186, RRID:AB_1858084
Product name
Anti-TMEM126B
Provider product page
Atlas Antibodies - HPA019186
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VKHDALKTYASLATLPFLSTVVTDKLFVIDALYSD
NISKENC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -