HPA067455

GMEB2 antibody from Atlas Antibodies
KIAA1269, P79PIF, PIF79

Antibody data

Product number
HPA067455
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA067455, RRID:AB_2685845
Product name
Anti-GMEB2
Provider product page
Atlas Antibodies - HPA067455
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKEL
KHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGP
AAMASQVLTQSAQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -