PAB20489

GMEB2 antibody from Abnova Corporation
KIAA1269, P79PIF, PIF79

Antibody data

Product number
PAB20489
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20489, RRID:AB_10965334
Product name
GMEB2 polyclonal antibody
Provider product page
Abnova Corporation - PAB20489
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GMEB2.
Antigen sequence
TSVPLGKVVSTLPSTVLGKGSLQAPPASSPASPLL
GGYTVLASSGSTYPSTVEIHPDASSLTVLSTAAVQ
DGSTVFKVVSPLQLLTLPGLGPTLQNVAQASPGSS
TIVTVPAGAAPGPEEHTATIE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -