HPA009706

GMEB2 antibody from Atlas Antibodies
KIAA1269, P79PIF, PIF79
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009706
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009706, RRID:AB_1078996
Product name
Anti-GMEB2
Provider product page
Atlas Antibodies - HPA009706
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TSVPLGKVVSTLPSTVLGKGSLQAPPASSPASPLL
GGYTVLASSGSTYPSTVEIHPDASSLTVLSTAAVQ
DGSTVFKVVSPLQLLTLPGLGPTLQNVAQASPGSS
TIVTVPAGAAPGPEEHTATIE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -