Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026543 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-USP44
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AIKSQNYHCTTRSGRFLRSMGTGDDSYFLHDGAQS
LLQSEDQLYTALWHRRRILMGKIFRTWFEQSPIGR
KKQEEPFQEKIVVKREVKKRRQELEYQVKAELESM
PPRKSLRLQGLAQSTIIEIVSVQVPAQTPASPAKD
KVLSTS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
USP44 regulates centrosome positioning to prevent aneuploidy and suppress tumorigenesis
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
USP44 regulates centrosome positioning to prevent aneuploidy and suppress tumorigenesis
Zhang Y, Foreman O, Wigle D, Kosari F, Vasmatzis G, Salisbury J, van Deursen J, Galardy P
Journal of Clinical Investigation 2012;122(12):4362-4374
Journal of Clinical Investigation 2012;122(12):4362-4374
No comments: Submit comment
No validations: Submit validation data