HPA008129

FMNL1 antibody from Atlas Antibodies
C17orf1, C17orf1B, FMNL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008129
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008129, RRID:AB_1848963
Product name
Anti-FMNL1
Provider product page
Atlas Antibodies - HPA008129
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDS
VLADVRSLQRGLELTQREFVRQDDCMVLKEFLRAN
SPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPG
LFFSLFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -