Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008129 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008129, RRID:AB_1848963
- Product name
- Anti-FMNL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDS
VLADVRSLQRGLELTQREFVRQDDCMVLKEFLRAN
SPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPG
LFFSLFS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Reliable and inexpensive expression of large, tagged, exogenous proteins in murine bone marrow-derived macrophages using a second generation lentiviral system.
Characterization of Leukocyte Formin FMNL1 Expression in Human Tissues.
Miller MR, Blystone SD
Journal of biological methods 2015;2(3):e23
Journal of biological methods 2015;2(3):e23
Characterization of Leukocyte Formin FMNL1 Expression in Human Tissues.
Gardberg M, Heuser VD, Iljin K, Kampf C, Uhlen M, Carpén O
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2014 Jun;62(6):460-470
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2014 Jun;62(6):460-470
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U-251MG and PC-3 using Anti-FMNL1 antibody. Corresponding FMNL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lymph node and liver tissues using HPA008129 antibody. Corresponding FMNL1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows cytoplasmic positivity in macrophages.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows cytoplasmic positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
- Sample type
- HUMAN