HPA028288

FMNL1 antibody from Sigma-Aldrich
C17orf1, C17orf1B, FMNL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028288
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028288, RRID:AB_10612110
Product name
Anti-FMNL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028288
Antibody type
Polyclonal
Antigen
formin-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KNAVLEHMEELQEQVALLTERLRDAENESMAKIAE
LEKQLSQARKELETLRERFSESTAMGASRRPPEPE
KAPPAAPTRPSALELKVEELEEKGLIRILRGPGDA
VSIEILPVAVATPSGGDAPTPGVPTGSPSPDLAPA
Storage
-20C
Provider Type Product Number
- No reagents -