HPA020734

AASS antibody from Sigma-Aldrich
LKRSDH, LORSDH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020734
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020734, RRID:AB_1844417
Product name
Anti-AASS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020734
Antibody type
Polyclonal
Antigen
Alpha-aminoadipic semialdehyde synthase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNA
WERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDK
DYVKAGGILQEDISEACLILGVKRPPEEKLMSRKT
YAFFSHTIKAQEANMGLLDEILKQEIR
Storage
-20C
Provider Type Product Number
- No reagents -