HPA003392

STRN3 antibody from Atlas Antibodies
PPP2R6B, S/G2NA, SG2NA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003392
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003392, RRID:AB_1079942
Product name
Anti-STRN3
Provider product page
Atlas Antibodies - HPA003392
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSAD
GTVRLWNPQEKLPCICTYNGDKKHGIPTSVDFIGC
DPAHMVTSFNTGSAVIYDLETSQSLVILSSQVDSG
LQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKT
GKMI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -