HPA004636

STRN3 antibody from Sigma-Aldrich
SG2NA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004636
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004636, RRID:AB_1079940
Product name
Anti-STRN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004636
Antibody type
Polyclonal
Antigen
Striatin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIK
RSSGDVLETFNFLENADDSDEDEENDMIEGIPEGK
DKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFL
VTAEDGEGAGEARSSGDGTEWAEPITFPSGGGKS
Storage
-20C
Provider Type Product Number
- No reagents -