Antibody data

Product number
PAB20359
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20359, RRID:AB_10964768
Product name
ADNP2 polyclonal antibody
Provider product page
Abnova Corporation - PAB20359
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ADNP2.
Antigen sequence
TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEP
EKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHH
LLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKL
PMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKL
GERE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -