HPA007126

ADNP2 antibody from Atlas Antibodies
KIAA0863, ZNF508
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007126
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007126, RRID:AB_1080729
Product name
Anti-ADNP2
Provider product page
Atlas Antibodies - HPA007126
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEP
EKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHH
LLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKL
PMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKL
GERE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -