HPA007126

ADNP2 antibody from MilliporeSigma / Merck KGaA
KIAA0863, ZNF508
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007126
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007126, RRID:AB_1080729
Product name
Anti-ADNP2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007126
Antibody type
Polyclonal
Antigen
ADNP homeobox protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEP
EKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHH
LLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKL
PMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKL
GERE
Storage
-20C
Provider Type Product Number
- No reagents -