Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405868 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Unc-50 Homolog (C. Elegans) (UNC50) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UNC50 antibody: synthetic peptide directed towards the N terminal of human UNC50
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLR
RLFRF RQMDFEFAAW- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of UNCL during development of periodontal tissue and response of periodontal ligament fibroblasts to mechanical stress in vivo and in vitro.
Kim HJ, Choi YS, Jeong MJ, Kim BO, Lim SH, Kim do K, Kim CK, Park JC
Cell and tissue research 2007 Jan;327(1):25-31
Cell and tissue research 2007 Jan;327(1):25-31
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting