HPA027009

UNC50 antibody from MilliporeSigma / Merck KGaA
GMH1, UNCL, URP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027009
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027009, RRID:AB_1858620
Product name
Anti-UNC50 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027009
Antibody type
Polyclonal
Antigen
Protein unc-50 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYL
RRL
Storage
-20C
Provider Type Product Number
- No reagents -