HPA016605

TRIP4 antibody from Sigma-Aldrich
HsT17391, ZC2HC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016605
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016605, RRID:AB_1858339
Product name
Anti-TRIP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016605
Antibody type
Polyclonal
Antigen
Activating signal cointegrator 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLP
HQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVID
DESDYFASDSNQWLSKLERETLQKREEELRELRHA
SRLSKKVTIDFAGRKILEEENSLA
Storage
-20C
Provider Type Product Number
- No reagents -