HPA005967

SNRPF antibody from Sigma-Aldrich
Sm-F
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005967
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005967, RRID:AB_1080044
Product name
Anti-HMGXB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005967
Antibody type
Polyclonal
Antigen
SMF protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAPATQFIMLPLPAYSVVENPTSIKLTTTYTRRGH
GTCTSPGCSFTYVTRHKPPKCPTCGNFLGGKWIPK
EKPAKVKVELASGVSSKGSVVKRNQQPVTTEQNSS
KENASKLTLENSEAVSQLLNVAPPREVGEESEWEE
VI
Storage
-20C
Provider Type Product Number
- No reagents -