Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004520-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004520-M01, RRID:AB_530133
- Product name
- MTF1 monoclonal antibody (M01), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MTF1.
- Antigen sequence
GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLV
GGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPG
STPMPRNIEGATLTLQSECPETKRKEVKRY- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Fetal exposure to cocaine causes programming of Prkce gene repression in the left ventricle of adult rat offspring.
Zhang H, Meyer KD, Zhang L
Biology of reproduction 2009 Mar;80(3):440-8
Biology of reproduction 2009 Mar;80(3):440-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MTF1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol