Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182727 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Inhibitor of Activated STAT, 4 (PIAS4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PIAS4 antibody: synthetic peptide directed towards the N terminal of human PIAS4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRA
LQLVQ FDCSPELFKK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references PIASy represses TRIF-induced ISRE and NF-kappaB activation but not apoptosis.
Identification of isoamylase, a glycogen-debranching enzyme, from Bacillus amyloliquefaciens.
Zhang J, Xu LG, Han KJ, Wei X, Shu HB
FEBS letters 2004 Jul 16;570(1-3):97-101
FEBS letters 2004 Jul 16;570(1-3):97-101
Identification of isoamylase, a glycogen-debranching enzyme, from Bacillus amyloliquefaciens.
Urlaub H, Wöber G
FEBS letters 1975 Sep 1;57(1):1-4
FEBS letters 1975 Sep 1;57(1):1-4
No comments: Submit comment
No validations: Submit validation data