HPA010598

PIAS4 antibody from Sigma-Aldrich
FLJ12419, Piasg, PIASY, ZMIZ6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010598
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010598, RRID:AB_1079616
Product name
Anti-PIAS4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010598
Antibody type
Polyclonal
Antigen
E3 SUMO-protein ligase PIAS4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRT
PLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLV
KLPFFNMLDELLKPTELVPQNNEKLQESPCIFALT
Storage
-20C
Provider Type Product Number
- No reagents -