HPA020621

IQUB antibody from Sigma-Aldrich
FLJ35834
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020621
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020621, RRID:AB_1844380
Product name
Anti-IQUB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020621
Antibody type
Polyclonal
Antigen
IQ and ubiquitin-like domain-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKEHECKLTQEILELIDREVDLMMRGVKHHNLEGL
RKRIATLFFHYIKTPLFNPEVAKYLKVPQDPLKFY
KKIYFCHSCQLYLPSTEFSVSSTSRRIYRCRNCIN
LQNEAQKRESFLKYKCLLQQLYYTEAD
Storage
-20C
Provider Type Product Number
- No reagents -