HPA019547

LMBRD1 antibody from Atlas Antibodies
bA810I22.1, C6orf209, cblF, FLJ11240
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019547
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019547, RRID:AB_2281256
Product name
Anti-LMBRD1
Provider product page
Atlas Antibodies - HPA019547
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KGTRSAAYERLENTEDIEEVEQHIQTIKSKSKDGR
PLPARDKRALKQFEERLRTLKKRERHLEFIENSWW
TKFCGALRP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -