HPA019547

LMBRD1 antibody from Sigma-Aldrich
bA810I22.1, C6orf209, cblF, FLJ11240
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019547
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019547, RRID:AB_2281256
Product name
Anti-LMBRD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019547
Antibody type
Polyclonal
Antigen
Probable lysosomal cobalamin transporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGTRSAAYERLENTEDIEEVEQHIQTIKSKSKDGR
PLPARDKRALKQFEERLRTLKKRERHLEFIENSWW
TKFCGALRP
Storage
-20C
Provider Type Product Number
- No reagents -