HPA024556

ZNF454 antibody from Sigma-Aldrich
FLJ37444
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024556
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024556, RRID:AB_1859283
Product name
Anti-ZNF454 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024556
Antibody type
Polyclonal
Antigen
Zinc finger protein 454 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPASKKSTVKAEIPEEELDQWTIKERFSSSSHWKC
ASLLEWQCGGQEISLQRVVLTHPNTPSQECDESGS
TMSSSLHSAQSQGFQP
Storage
-20C
Provider Type Product Number
- No reagents -