HPA024549

SPATA32 antibody from Atlas Antibodies
AEP2, C17orf46, FLJ25414, TEX34, VAD1.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024549
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024549, RRID:AB_1845589
Product name
Anti-SPATA32
Provider product page
Atlas Antibodies - HPA024549
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSAC
HHSISAQTSKHLFWANKLIQASEHSLQRAINMQLN
NGSAGQPIRSPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -